PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10018700m
Common NameCARUB_v10018700mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 228aa    MW: 25509.2 Da    PI: 6.9604
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10018700mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-172168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
  Carubv10018700m 21 KGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYL 68
                     79********************************************97 PP

2Myb_DNA-binding53.94e-1774117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++
  Carubv10018700m  74 RGNITPEEQLIIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 117
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9981668IPR017930Myb domain
SuperFamilySSF466897.49E-3019115IPR009057Homeodomain-like
SMARTSM007171.8E-122070IPR001005SANT/Myb domain
PfamPF002491.9E-162168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-232275IPR009057Homeodomain-like
CDDcd001672.14E-102368No hitNo description
PROSITE profilePS5129424.86569123IPR017930Myb domain
SMARTSM007175.0E-1573121IPR001005SANT/Myb domain
PfamPF002497.1E-1674117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2476122IPR009057Homeodomain-like
CDDcd001673.14E-1278117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MEKRGGSSGG SGSSVEAEVR KGPWTMEEDL ILINYIANHG DGVWNSLAKS AGLKRTGKSC  60
RLRWLNYLRP DVRRGNITPE EQLIIMELHA KWGNRWSKIA KHLPGRTDNE IKNFWRTRIQ  120
KYIKQADATT TSSVGSHHSS EINDQAASTS SHNVFCTQDQ AMETYSPTPT SYQQHTNMEF  180
NYGGNYSAAA TTTTVDYPIP MTVDDQTGEN YWGMDDIWSS MHLLNGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261812324128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1184390.0AK118439.1 Arabidopsis thaliana At3g27810 mRNA for putative myb family transcription factor (Atmyb3), complete cds, clone: RAFL19-68-M03.
GenBankAY5195890.0AY519589.1 Arabidopsis thaliana MYB transcription factor (At3g27810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292470.11e-172hypothetical protein CARUB_v10018700mg
SwissprotQ9LK951e-155MYB21_ARATH; Transcription factor MYB21
TrEMBLR0HN701e-172R0HN70_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50004451e-153(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-145myb domain protein 21